LL-37 trifluoroacetate salt,CAS : 154947-66-7
H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH trifluoroacetate salt
Product description
LL-37 is an antimicrobial peptide with angiogenic activity. LL-37 has been suggested to stimulate epithelial cell proliferation partially through formyl peptide receptor-like 1 (FPRL1) since blocking the receptor with pertussis toxin decreased the proliferative effect of LL-37 by approximately 50 %.
| Appearance | N/A |
|---|---|
| Molecular weight | N/A |
| Purity | >90% |
| Solubility | N/A |
| Cas | 154947-66-7 |
| Sequence | [LL-37, 37 aa] |
| Synonyms | LL37, Antibacterial Protein LL-37 (human), CAMP |
| Molecular Formula | C₂₀₅H₃₄₀N₆₀O₅₃ |
| Storage | -20℃, protected from light and moisture |
| Transportation | 4-25℃ temperature for up to 3 weeks |
| Stability | 1 year |
Document
Related Product

Items-$0.00

Email:
Tel.:
msds of LL-37 trifluoroacetate salt
RuixiBiotechCo.Ltd /KamulinBiotechco.ltd
Add: Room 20F 2002, Meiyuan Building, Yanta District, Xi’ an City, Shaanxi Province 710061 China
Tel: 02988811435
Fax: (86-29)8881-1435
Email: sales@ruixibiotech.com
Web: http://www.ruixibiotech.com


